DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and DRIP2

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001323803.1 Gene:DRIP2 / 817608 AraportID:AT2G30580 Length:420 Species:Arabidopsis thaliana


Alignment Length:429 Identity:90/429 - (20%)
Similarity:141/429 - (32%) Gaps:157/429 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 CHLCQGYLINATTIVECLHSFCHSCLINHLRKERF--CPRCEMVINNAK-PNIKSDTTLQAIVYK 324
            |.||...|.:||||.||||:||..|:...:.::..  ||.|::.:.... ..::.|..||.:..|
plant    20 CPLCDKLLRDATTISECLHTFCRKCIYEKITEDEIESCPVCDIDLGGTPLEKLRPDHILQDLRAK 84

  Fly   325 LVPGLYERELMRKR-------------AFYKDRP-EEAALATPE---QRGDDTEHLIFSPSDDMS 372
            |.|      |.||:             |..|:|. ....::||.   |.|...:....:...|:.
plant    85 LFP------LKRKKERAPEVVSSISLPAKRKERSISSLVVSTPRVSAQAGTTGKRTKAATRKDVR 143

  Fly   373 LSLEYA--------ELGE--LKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKFE------- 420
            .|..:.        |.|:  :::.|.||.                   ||||..:|.:       
plant   144 GSGSFTKRTVKKEEEFGDDHVESASSPET-------------------LKKFTQNKRQSSYANPN 189

  Fly   421 ---IDAQRFSIDIMYKVKTIVLLDYYTLMDIAYIYTWKRDAPMRFYYRVYESPQPLVKPAPRRVL 482
               .:.:...:|..:..|               ::.||   |:.|...|...             
plant   190 QSLSNRRNKDVDEPWDSK---------------LHLWK---PLNFLVDVANG------------- 223

  Fly   483 PLKLEKQERENQEQQLAVEVASSKVEPVSLPEDQKAEASIKVEEQESTREIVKEVIKDVAATPPT 547
             .|..|.|..|....   :|..||.:    .:|.|.:.  |:||:.|.        .....|..|
plant   224 -TKDPKSELGNASHN---DVQGSKTK----TKDHKRKC--KLEEEISN--------NGDPTTSET 270

  Fly   548 ETLKLVINRNMLDKREKSHS------PQMSSKSSSK---------------SSPCTPVSSPSEP- 590
            .|||    |....:|::|.:      |.:...:|.|               |:.....|.|..| 
plant   271 ATLK----RTRRTRRKRSSTFGDSRIPLLPGAASLKQERRNGHVWFSLVASSNQEGEASLPQIPA 331

  Fly   591 --------NIKL---------KIDLSKQNSVTIIDMSDP 612
                    ||.:         |:||..::.|.|..|.:|
plant   332 NYLRIRDGNIPVSFIQKYLMRKLDLKSEDEVEITCMGEP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 17/39 (44%)
RAWUL 384..465 CDD:292824 14/90 (16%)
DRIP2NP_001323803.1 RING_Ubox 19..61 CDD:418438 17/40 (43%)
RAWUL_DRIP_like 310..412 CDD:340607 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.