DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Pcgf5

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001355619.1 Gene:Pcgf5 / 76073 MGIID:1923505 Length:256 Species:Mus musculus


Alignment Length:232 Identity:68/232 - (29%)
Similarity:116/232 - (50%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NI 312
            |..|:...||:|.|::|:||||..||:.||||:||.:|::.|......||||...::...|  .:
Mouse     5 RKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEML 69

  Fly   313 KSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRG-DDTEHLIFSPSDDMSLSLE 376
            :.|.||:.|::||||||.|:||.|:..|:|..       .|::.| ||...:..|.:|       
Mouse    70 RLDNTLEEIIFKLVPGLREQELQRELEFWKKN-------KPQENGQDDISKVDKSKAD------- 120

  Fly   377 YAELGELKTD------SEPEL---VDTLR--------------PRYLQCPAMCRVSHLKKFVYDK 418
              |.|:...|      |:|::   :|.||              .::::|.....|..:|||:..|
Mouse   121 --EEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLK 183

  Fly   419 FEIDAQRFSIDIMYKVKTIVLLDYYTLMDIAYIYTWK 455
            .::.:. :.:|::...: |:..|:  .|:..|:..|:
Mouse   184 LKLPSS-YELDVLCNGE-IMGKDH--TMEFIYMTRWR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 18/37 (49%)
RAWUL 384..465 CDD:292824 18/95 (19%)
Pcgf5NP_001355619.1 rad18 8..>135 CDD:273165 50/142 (35%)
RING-HC_PCGF5 16..57 CDD:319651 20/40 (50%)
RING-HC finger (C3HC4-type) 18..56 CDD:319651 18/37 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..133 9/39 (23%)
RAWUL_PCGF5 136..256 CDD:340604 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3210
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.