DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Pcgf3

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001363929.1 Gene:Pcgf3 / 69587 MGIID:1916837 Length:259 Species:Mus musculus


Alignment Length:211 Identity:75/211 - (35%)
Similarity:107/211 - (50%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NI 312
            |.:.|..:|.||.|.||.||||:|||:.||||:||.|||:.:|.:...||.|.:||:.:.|  .|
Mouse     4 RKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYI 68

  Fly   313 KSDTTLQAIVYKLVPGLYERELMRKRAFYK--------DRPEEAALA-------TPEQRGDDT-- 360
            ..|.|:|.|||||||||.|.|:.::|.||.        |...||..|       ..|.:.||.  
Mouse    69 GHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLDPRNGETKADDNSN 133

  Fly   361 ---------EHLIFSPSDD-MSLSLEYAELGELKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFV 415
                     |...:..||: :|:.|| ....:|:         .|:.::::|.|...|.|||||:
Mouse   134 KETAEEKQEEDNDYHRSDEQVSICLE-CNSSKLR---------GLKRKWIRCSAQATVLHLKKFI 188

  Fly   416 YDKFEIDAQRFSIDIM 431
            ..|..:.:.. .:||:
Mouse   189 AKKLNLSSFN-ELDIL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 22/37 (59%)
RAWUL 384..465 CDD:292824 12/48 (25%)
Pcgf3NP_001363929.1 RING-HC_PCGF3 14..60 CDD:319649 26/45 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..148 5/32 (16%)
RAWUL_PCGF3 153..226 CDD:340603 16/62 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.