DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Pcgf5

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:XP_017445196.1 Gene:Pcgf5 / 681178 RGDID:1583513 Length:253 Species:Rattus norvegicus


Alignment Length:231 Identity:66/231 - (28%)
Similarity:113/231 - (48%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NI 312
            |..|:...||:|.|::|:||||..||:.||||:||.:|::.|......||||...::...|  .:
  Rat     5 RKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEML 69

  Fly   313 KSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRGDDTEHLIFSPSDDMSLSLEY 377
            :.|.||:.|::||||||.|:||.|:..|:|..       .|::.|.|....:.....|       
  Rat    70 RLDNTLEEIIFKLVPGLREQELQRELEFWKKN-------KPQENGQDEVSKVDKSKAD------- 120

  Fly   378 AELGELKTD------SEPEL---VDTLR--------------PRYLQCPAMCRVSHLKKFVYDKF 419
             |.|:...|      |:|::   :|.||              .::::|.....|..:|||:..|.
  Rat   121 -EEGDENQDDKDYHRSDPQIAICLDCLRNHGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKL 184

  Fly   420 EIDAQRFSIDIMYKVKTIVLLDYYTLMDIAYIYTWK 455
            ::.:. :.:|::...: |:..|:  .|:..|:..|:
  Rat   185 KLPSS-YELDVLCNGE-IMGKDH--TMEFIYMTRWR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 18/37 (49%)
RAWUL 384..465 CDD:292824 18/95 (19%)
Pcgf5XP_017445196.1 zf-C3HC4 18..56 CDD:278524 18/37 (49%)
RAWUL 154..216 CDD:292824 11/65 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.