DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and RNF2

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_009143.1 Gene:RNF2 / 6045 HGNCID:10061 Length:336 Species:Homo sapiens


Alignment Length:304 Identity:65/304 - (21%)
Similarity:110/304 - (36%) Gaps:86/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 TSDLATTSRPRPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRK-ERFCPRCEM 303
            |..|.....||     :::..::|.:|...|.|..|..||||.||..|:|..||. .:.||.|..
Human    33 TDGLEIVVSPR-----SLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRK 92

  Fly   304 VINNAKPNIKSDTTLQAIVYKLVPGLYERELMRKRA---FYKDRPEEAALATPE----------- 354
            .: .:|.:::.|....|::.|:.|...|.|..::|.   ..|...::|...:.|           
Human    93 KL-VSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRL 156

  Fly   355 QRG--------------DDTEHLI----------------FSPSDDMSLSLEYAELGELKTD--- 386
            |||              .|:.|..                ...|||..|.|:... ..:..|   
Human   157 QRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNN-AAMAIDPVM 220

  Fly   387 ---SEPELV-----------DTLRPRYLQCPAMCRVSHLKKFVYDKFEI-------DAQRFSIDI 430
               ||.|||           |:.:.||::......|.||.|::..:..:       ::.:.::|.
Human   221 DGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDT 285

  Fly   431 ----MYKVKTIVLLDYYTLMDIAYIYT------WKRDAPMRFYY 464
                .|.:........:|:::.::...      ||.:.||..||
Human   286 ASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 17/38 (45%)
RAWUL 384..465 CDD:292824 22/115 (19%)
RNF2NP_009143.1 Interaction with HIP2. /evidence=ECO:0000269|PubMed:11513855 2..179 37/151 (25%)
COG5222 <11..>103 CDD:227547 23/75 (31%)
RING-HC_RING1_like 51..91 CDD:319445 17/39 (44%)
Interaction with nucleosomes via an acidic patch on histone H2A and histone H2B. /evidence=ECO:0000269|PubMed:25355358 93..98 0/5 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..208 9/50 (18%)
RAWUL_RING2 225..330 CDD:340687 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.