DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and pcgf5a

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001122184.1 Gene:pcgf5a / 562327 ZFINID:ZDB-GENE-080723-33 Length:234 Species:Danio rerio


Alignment Length:235 Identity:61/235 - (25%)
Similarity:113/235 - (48%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NI 312
            |..|:...|.:|.|.:|:||||..|.:.||||:||.||::.|..:...||.|.:.::...|  .:
Zfish     5 RKHLVRDFNRYITCSICRGYLIKPTAVTECLHTFCKSCIVQHFEESNECPECGIQVHETNPLEML 69

  Fly   313 KSDTTLQAIVYKLVPGLYERELMRKRAFYK-----------DRPEEAALATPEQRGDDTEHLIFS 366
            :.|.||:.|::||||||.|:|..::..|::           .|.:::.|:..:..|:..::....
Zfish    70 RLDKTLEEIIFKLVPGLREKEEHQESEFWRKHKIKSNGEDGPRAKKSRLSGEDDDGNGGDYHRSD 134

  Fly   367 PSDDMSLSL--EYAELGELKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKFEIDAQRFSID 429
            |...:.|..  ...:.||       .:|..|..::::|.....|..:|||:..|.::.:. :.:|
Zfish   135 PQIAICLDCLRNNGQSGE-------SIVKGLMKKFIRCSTRVTVGTIKKFLCVKLKLPSS-YELD 191

  Fly   430 IMYKVKTIVLLDYYTLMDIAYIYTWKRDA----PMRFYYR 465
            ::...: |:..|:  .::..|...|:...    ||...||
Zfish   192 VLCNGE-IMGKDH--TLEFIYRTRWRLQGDSAYPMVLEYR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 18/37 (49%)
RAWUL 384..465 CDD:292824 15/84 (18%)
pcgf5aNP_001122184.1 zf-C3HC4 18..56 CDD:278524 18/37 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..130 4/32 (13%)
RAWUL 155..228 CDD:292824 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593695
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.