DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and pcgf1

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001016417.2 Gene:pcgf1 / 549171 XenbaseID:XB-GENE-6454077 Length:259 Species:Xenopus tropicalis


Alignment Length:234 Identity:76/234 - (32%)
Similarity:116/234 - (49%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 VLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NIKS 314
            |.:..:|.||:|:||.||.|:||||.||||:||.||::.:|:..::||.|.:.|:..:|  |:|.
 Frog    34 VKIKELNEHIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPLCNIKIHETQPLLNLKL 98

  Fly   315 DTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAAL---ATPEQRGD------------DTEHLI 364
            |..:|.|||||||||.|.|..|.|.||..|..|..|   |..:..||            .|.| .
 Frog    99 DRVMQDIVYKLVPGLQENEDGRIRDFYHSRGLERVLQPSAVEDSVGDVSQLSLSLAVSQKTSH-Y 162

  Fly   365 FSPSDDMSLSLEYAELGELKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKFEIDAQRFSID 429
            :...:.:.|.||....|:.|...      .|..:|::|.....:.||::.:  ...:.|....:.
 Frog   163 YRNDEHVCLCLEKVSSGKDKKKF------ILEQKYVRCSVRSEIRHLRRVL--SHRLSAPLAHVQ 219

  Fly   430 IMYKVKTIVLLDYYTLMDIAYIYTWKRDAPMRFYYRVYE 468
            ::...|  ||.|:.|:..:...:.:.:.||:...|.|.|
 Frog   220 LLIDNK--VLPDHMTMKQLWLTHWYGKPAPLVLLYSVRE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 21/37 (57%)
RAWUL 384..465 CDD:292824 14/80 (18%)
pcgf1NP_001016417.2 zf-C3HC4 45..83 CDD:278524 21/37 (57%)
RAWUL 177..253 CDD:292824 15/85 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.