DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and l(3)73Ah

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster


Alignment Length:225 Identity:80/225 - (35%)
Similarity:118/225 - (52%) Gaps:19/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NI 312
            |.|.|..:||||.|.:|.||.|:|||:.||||:||.|||:.||.:::.||.|:.:|:.:.|  .|
  Fly     3 RRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYI 67

  Fly   313 KSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRGDDTEHLIFSPSDDMSLSLEY 377
            ..|.|:|.|||||||.|.|.|..|:|.|||.|.........:...||.|.::     |.....::
  Fly    68 SFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVM-----DAHAESDF 127

  Fly   378 AELGE-----LKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKFEIDAQRF-SIDIMYKVKT 436
            ..|.|     |:..|..  ...|:.|:::|.:...::||||.|..|.....::: .|||:...: 
  Fly   128 HRLDEQVNVCLECISNN--FKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDILCNEE- 189

  Fly   437 IVLLDYYTLMDIAYIYTWK-RDAPMRFYYR 465
              ||.....:...|:..|: ||.|:|..:|
  Fly   190 --LLGKDHTLKFVYVTRWRFRDPPLRLQFR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 21/37 (57%)
RAWUL 384..465 CDD:292824 21/82 (26%)
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 24/45 (53%)
RAWUL_PCGF3 133..217 CDD:340603 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467330
Domainoid 1 1.000 52 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E1_KOG2660
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.