DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Ring1

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_997714.2 Gene:Ring1 / 309626 RGDID:3576 Length:406 Species:Rattus norvegicus


Alignment Length:193 Identity:46/193 - (23%)
Similarity:82/193 - (42%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 TAAVAASSTATTTSDLATTSR-PRPVLL----TAVNP-----HIICHLCQGYLINATTIVECLHS 282
            |.|.|.:::.|....|....| |:..::    .||:|     .::|.:|...|.|..|..||||.
  Rat     3 TPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHR 67

  Fly   283 FCHSCLINHLRK-ERFCPRCEMVINNAKPNIKSDTTLQAIVYKLVPGLYERELMRKRAFYK--DR 344
            ||..|::..||. .:.||.|...: .:|.:::.|....|::.|:.|...|.|..:.|...:  ..
  Rat    68 FCSDCIVTALRSGNKECPTCRKKL-VSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRL 131

  Fly   345 PEEAALATPEQRGDDTEHLIFS-------PSDDMSLSLEYAELGE----------LKTDSEPE 390
            ..:.||::..:.|...:.:..:       |..|.:.::...| ||          :.:||.|:
  Rat   132 HNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTTTMSGGE-GEPGEGEGDGEDISSDSAPD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 16/38 (42%)
RAWUL 384..465 CDD:292824 3/7 (43%)
Ring1NP_997714.2 Necessary for transcriptional repression. /evidence=ECO:0000250 30..234 39/166 (23%)
RING-HC_RING1 47..90 CDD:319653 17/42 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..263 8/44 (18%)
Nuclear localization signal. /evidence=ECO:0000250 201..204
Necessary for interaction with CBX2. /evidence=ECO:0000250 230..406
RAWUL_RING1 261..400 CDD:340686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.