DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Pcgf6

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:XP_008758660.1 Gene:Pcgf6 / 309457 RGDID:1306904 Length:365 Species:Rattus norvegicus


Alignment Length:368 Identity:105/368 - (28%)
Similarity:162/368 - (44%) Gaps:54/368 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 TTTTATPALATGKAAKTILENGIKKESTP---PAVESVEASSSSSSSSSSSSSSSSSWPTTRRAT 206
            |..|.....:..|.|..:|.......|.|   ||..:.|...:|.:.:.:...|.|..|......
  Rat     6 TDATENKRASEAKRASAMLPPPPPPISPPALIPAPAAGEEGPASLAQAGAPGCSRSRPPELEPER 70

  Fly   207 S------------EDASSNGGASADEEKSEEDPTAAVAASSTATTTSDLATTSRPRPVLLTAVNP 259
            |            |:...:.....:||:.||....::...|....:.|    ...|.:.|..:.|
  Rat    71 SLGRLRGRFEDYDEELEEDEEMEEEEEEEEEMSHFSLRLESGRADSED----EEERLINLVELTP 131

  Fly   260 HIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NIKSDTTLQAIV 322
            :|:|.:|:||||:||||.||||:||.||::.|......||:|.:|::..:|  ||:.|..||.||
  Rat   132 YILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIV 196

  Fly   323 YKLVPGLYERELMRKRAFYKDR----PEEAAL---------ATPEQRGDDTEHL--IF--SPSDD 370
            ||||..|.|||..:...|||:|    |:.|:|         ..|..:|...:.|  :|  .|..|
  Rat   197 YKLVVNLEEREKKQMHDFYKERGLEVPKPASLFPSQIAVPQPVPASKGRTKKALESVFRIPPELD 261

  Fly   371 MSLSLEY----AELGELKTD--SEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKFEIDAQRFSID 429
            :||.||:    .:.|..|..  .||     |..::::......:.|::||:..|..:| ....:|
  Rat   262 VSLLLEFIGANEDTGHFKHSLRFEP-----LEKKFVRVSGEATIGHVEKFLRRKMGLD-PACQVD 320

  Fly   430 IMYKVKTIVLLDYYTLMDI--AYIYTWKRDAPMRFYYRVYESP 470
            |:  ....:|..|.||.:|  |...|..:|..:..:|.:..||
  Rat   321 II--CGDHLLERYQTLREIRRAIGDTAMQDGLLVLHYGLVVSP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 21/37 (57%)
RAWUL 384..465 CDD:292824 19/84 (23%)
Pcgf6XP_008758660.1 RING-HC_PCGF6 131..175 CDD:319652 24/43 (56%)
COG5222 <135..258 CDD:227547 50/122 (41%)
RAWUL_PCGF6 261..356 CDD:340605 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.