Sequence 1: | NP_001286368.1 | Gene: | Psc / 36431 | FlyBaseID: | FBgn0005624 | Length: | 1601 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001347773.1 | Gene: | Rnf2 / 19821 | MGIID: | 1101759 | Length: | 345 | Species: | Mus musculus |
Alignment Length: | 345 | Identity: | 70/345 - (20%) |
---|---|---|---|
Similarity: | 121/345 - (35%) | Gaps: | 98/345 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 204 RATSEDASSNGGASADEE------KSEEDPTAAVAASSTATTTSDLATTSRPRPVLLTAVNPHII 262
Fly 263 CHLCQGYLINATTIVECLHSFCHSCLINHLRK-ERFCPRCEMVINNAKPNIKSDTTLQAIVYKLV 326
Fly 327 PGLYERELMRKRA---FYKDRPEEAALATPE-----------QRG--------------DDTEHL 363
Fly 364 I----------------FSPSDDMSLSLEYAELG-----ELKTDSEPELV-----------DTLR 396
Fly 397 PRYLQCPAMCRVSHLKKFVYDKFEI-------DAQRFSIDI----MYKVKTIVLLDYYTLMDIAY 450
Fly 451 IYT------WKRDAPMRFYY 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Psc | NP_001286368.1 | zf-C3HC4 | 263..301 | CDD:278524 | 17/38 (45%) |
RAWUL | 384..465 | CDD:292824 | 21/109 (19%) | ||
Rnf2 | NP_001347773.1 | RING-HC_RING2 | 56..102 | CDD:319654 | 18/45 (40%) |
RING-HC finger (C3HC4-type) | 60..99 | CDD:319654 | 17/38 (45%) | ||
RAWUL_RING2 | 234..339 | CDD:340687 | 20/105 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167848280 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |