DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Rnf2

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001347773.1 Gene:Rnf2 / 19821 MGIID:1101759 Length:345 Species:Mus musculus


Alignment Length:345 Identity:70/345 - (20%)
Similarity:121/345 - (35%) Gaps:98/345 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RATSEDASSNGGASADEE------KSEEDPTAAVAASSTATTTSDLATTSRPRPVLLTAVNPHII 262
            |..|:...:||.....:.      :.:..|..|:        |..|.....||     :::..::
Mouse     8 REMSQAVQTNGTQPLSKTWELSLYELQRTPQEAI--------TDGLEIVVSPR-----SLHSELM 59

  Fly   263 CHLCQGYLINATTIVECLHSFCHSCLINHLRK-ERFCPRCEMVINNAKPNIKSDTTLQAIVYKLV 326
            |.:|...|.|..|..||||.||..|:|..||. .:.||.|...: .:|.:::.|....|::.|:.
Mouse    60 CPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKL-VSKRSLRPDPNFDALISKIY 123

  Fly   327 PGLYERELMRKRA---FYKDRPEEAALATPE-----------QRG--------------DDTEHL 363
            |...|.|..::|.   ..|...::|...:.|           |||              .|:.|.
Mouse   124 PSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHC 188

  Fly   364 I----------------FSPSDDMSLSLEYAELG-----ELKTDSEPELV-----------DTLR 396
            .                ...|||..|.|:.....     .:...||.|||           |:.:
Mouse   189 SNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQ 253

  Fly   397 PRYLQCPAMCRVSHLKKFVYDKFEI-------DAQRFSIDI----MYKVKTIVLLDYYTLMDIAY 450
            .||::......|.||.|::..:..:       ::.:.::|.    .|.:........:|:::.::
Mouse   254 TRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSF 318

  Fly   451 IYT------WKRDAPMRFYY 464
            ...      ||.:.||..||
Mouse   319 SLELVSEKYWKVNKPMELYY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 17/38 (45%)
RAWUL 384..465 CDD:292824 21/109 (19%)
Rnf2NP_001347773.1 RING-HC_RING2 56..102 CDD:319654 18/45 (40%)
RING-HC finger (C3HC4-type) 60..99 CDD:319654 17/38 (45%)
RAWUL_RING2 234..339 CDD:340687 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.