DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and Ring1

DIOPT Version :10

Sequence 1:NP_523725.2 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_033092.3 Gene:Ring1 / 19763 MGIID:1101770 Length:406 Species:Mus musculus


Alignment Length:126 Identity:35/126 - (27%)
Similarity:58/126 - (46%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 TAAVAASSTATTTSDLATTSR-PRPVLL----TAVNP-----HIICHLCQGYLINATTIVECLHS 282
            |.|.|.:::.|....|....| |:..::    .||:|     .::|.:|...|.|..|..||||.
Mouse     3 TPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHR 67

  Fly   283 FCHSCLINHLRK-ERFCPRCEMVINNAKPNIKSDTTLQAIVYKLVPGLYERELMRKRAFYK 342
            ||..|::..||. .:.||.|...: .:|.:::.|....|::.|:.|...|.|..:.|...:
Mouse    68 FCSDCIVTALRSGNKECPTCRKKL-VSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_523725.2 RING_Ubox 254..341 CDD:473075 28/96 (29%)
RAWUL_PCGF2_like 371..465 CDD:340602
PHA03247 <1160..1381 CDD:223021
Ring1NP_033092.3 Necessary for transcriptional repression 30..234 28/99 (28%)
RING-HC_RING1 43..112 CDD:438397 21/69 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..263
Nuclear localization signal. /evidence=ECO:0000250 201..204
Necessary for interaction with CBX2. /evidence=ECO:0000269|PubMed:9312051 230..406
RAWUL_RING1 261..400 CDD:340686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..354
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.