DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and pcgf3

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:XP_021336949.1 Gene:pcgf3 / 101884364 -ID:- Length:250 Species:Danio rerio


Alignment Length:260 Identity:81/260 - (31%)
Similarity:131/260 - (50%) Gaps:53/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LATTSRP----RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEM 303
            :|.|:.|    |.:.|..:|.||.|.||:||||:|||:.||||:||.|||:.:|.:...||.|.:
Zfish     1 MAATANPEMLTRKIKLWDINAHITCRLCEGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRI 65

  Fly   304 VINNAKP--NIKSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRGDDTEHLIFS 366
            ||:.:.|  .|..|.|:|.|||||||||.|.|:.::|.||    ::..:..|   ||....|.  
Zfish    66 VIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMKKQRDFY----QKLGMEVP---GDIKGELC-- 121

  Fly   367 PSDDMSLSLEYAELGELKTD--------------------SEPEL----------VDTLRPRYLQ 401
               :|.:..:....||||::                    |:.::          :..|:.::::
Zfish   122 ---NMKIHPDSQRNGELKSEDPASKEAGEEKAEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIR 183

  Fly   402 CPAMCRVSHLKKFVYDKFEIDAQRFSIDIMYKVKTIVLLDYYTLMDIAYIYTWK-RDAPMRFYYR 465
            |.|...|.|||||:..|..:.:.. .:||:...:  :|...:||..:. :..|: :.:|:..:||
Zfish   184 CSAQATVLHLKKFIAKKLNLTSFN-ELDILCNEE--ILGKDHTLKFVV-VTRWRFKKSPLLLHYR 244

  Fly   466  465
            Zfish   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 22/37 (59%)
RAWUL 384..465 CDD:292824 19/111 (17%)
pcgf3XP_021336949.1 RING-HC_PCGF3 22..68 CDD:319649 26/45 (58%)
RING-HC finger (C3HC4-type) 25..63 CDD:319649 22/37 (59%)
RAWUL 180..244 CDD:318447 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.