DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and AgaP_AGAP006102

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_001688783.1 Gene:AgaP_AGAP006102 / 5667303 VectorBaseID:AGAP006102 Length:144 Species:Anopheles gambiae


Alignment Length:140 Identity:74/140 - (52%)
Similarity:89/140 - (63%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFE 69
            |||.|:|:|..||..:..|.|||...||||||:|.|::|||||:|.|..|||.:||||......|
Mosquito     4 TWIPTSVHGPYPPHMVPGGVDSDGAQIFVGRAHHAGDLLPAKVIPDKTAAYVAYGGQETLVEHVE 68

  Fly    70 VLVGDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEH 134
            |||.....|..:|.|.||..|:..|.|.:||.|||||.|.:||.|.|||..||.|:||||||.|.
Mosquito    69 VLVHKQLIWDTASAGQVPLGAVVGGHTSDGEILYVGRAYHEGSQTIGKVQCSHNCIYIPYGGAEV 133

  Fly   135 RLEAYEVLVQ 144
            .:..||||.:
Mosquito   134 SVPTYEVLCE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 37/67 (55%)
DUF3421 25..135 CDD:288732 61/109 (56%)
DM9 75..143 CDD:128937 35/67 (52%)
DM9 147..215 CDD:128937
DUF3421 166..276 CDD:288732
DM9 216..286 CDD:128937
AgaP_AGAP006102XP_001688783.1 DM9 4..71 CDD:128937 36/66 (55%)
DUF3421 24..134 CDD:288732 61/109 (56%)
DM9 77..142 CDD:128937 35/64 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.