DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and RFWD3

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001357463.1 Gene:RFWD3 / 55159 HGNCID:25539 Length:774 Species:Homo sapiens


Alignment Length:289 Identity:57/289 - (19%)
Similarity:80/289 - (27%) Gaps:113/289 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QEISKHDFEVLVGDHFS--WI----PSSGGSVPPH--------AIQVGQTGEG---------EPL 102
            |:::.|..:.|.....|  |:    |||.|.   |        ...|.|.|..         ..|
Human   401 QKLTSHQSQNLQQPRGSQAWVLSCSPSSQGQ---HKHKYHFQKTFTVSQAGNCRIMAYCDALSCL 462

  Fly   103 YVGRGYFQGSLTPG------KVHPSHQCLYIPYGGQEHRLEAYEVLVQPETWIASSGR-----GI 156
            .:.:...|.|..||      .........|||..|::.|..|:...::.....||...     .:
Human   463 VISQPSPQASFLPGFGVKMLSTANMKSSQYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSL 527

  Fly   157 VPGTVVGGHDA------------DGDQIYVGRA-------------YHEGDLLPAKV-------- 188
            ...|||..::|            :.:.||.|.|             .|..:|:..|.        
Human   528 ETNTVVQTYNAGRPVWSCCWCLDEANYIYAGLANGSILVYDVRNTSSHVQELVAQKARCPLVSLS 592

  Fly   189 -IPNKGCAYVPYGGGEVVKHDYELLAGYGYGWVHDSHGNVPGNAVLCGRTSDG----EPLFIGRA 248
             :|....|..||||                              ||.|...|.    :.:.....
Human   593 YMPRAASAAFPYGG------------------------------VLAGTLEDASFWEQKMDFSHW 627

  Fly   249 HHHGSLTPGKI------HQSHHCL--YIP 269
            .|...|.||..      :.|.|||  |.|
Human   628 PHVLPLEPGGCIDFQTENSSRHCLVTYRP 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 3/11 (27%)
DUF3421 25..135 CDD:288732 22/102 (22%)
DM9 75..143 CDD:128937 21/96 (22%)
DM9 147..215 CDD:128937 19/106 (18%)
DUF3421 166..276 CDD:288732 28/150 (19%)
DM9 216..286 CDD:128937 14/66 (21%)
RFWD3NP_001357463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..116
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..280
mRING-C3HGC3_RFWD3 283..331 CDD:319364
WD40 <486..774 CDD:225201 39/201 (19%)
WD 1 495..537 8/41 (20%)
WD40 repeat 500..537 CDD:293791 7/36 (19%)
WD 2 539..577 5/37 (14%)
WD40 repeat 543..580 CDD:293791 5/36 (14%)
WD 3 583..628 11/74 (15%)
WD40 repeat 588..655 CDD:293791 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.