DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and LOC4578182

DIOPT Version :10

Sequence 1:NP_610831.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_001238018.1 Gene:LOC4578182 / 4578182 VectorBaseID:AGAMI1_000873 Length:181 Species:Anopheles gambiae


Alignment Length:143 Identity:50/143 - (34%)
Similarity:75/143 - (52%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEV 70
            |:.....|.|||.|:..| .|.:..:::|||.|.|.:.|..:.|.|:..|:||||:...|...|:
Mosquito    42 WVPYQDSGPLPPSAVECG-TSKRTKLYLGRAEHAGSVTPGFINPAKKVCYIPWGGKAHEKKVCEI 105

  Fly    71 L--VGDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQE 133
            |  .|:   ::|.:..:|...|...|.:.:|||||:||....|.|..|||..||...||||..:|
Mosquito   106 LCTAGE---FVPCTETNVLLRATPAGVSEQGEPLYIGRVAVDGQLVCGKVQRSHSVCYIPYNRKE 167

  Fly   134 HRLEAYEVLVQPE 146
            .....:||.::.:
Mosquito   168 EPHVNFEVFIKSQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_610831.1 DUF3421 26..135 CDD:463390 41/110 (37%)
DUF3421 168..277 CDD:463390
LOC4578182XP_001238018.1 DUF3421 65..167 CDD:463390 39/104 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.