DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and CG31086

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:142 Identity:74/142 - (52%)
Similarity:103/142 - (72%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDYTWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISK 65
            |..::|:..: .|::|..|::||||||.|.||:|||::..:|||||::|.|.:|||.:..||:..
  Fly     1 MDGHSWLHFS-NGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVEL 64

  Fly    66 HDFEVLVGDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYG 130
            .::|||.|.::.|:|:..|.|||.|::|||..:||.||.||||..||||.|||||||.||||||.
  Fly    65 ENYEVLSGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYD 129

  Fly   131 GQEHRLEAYEVL 142
            .:|.::.|||||
  Fly   130 SEEVKIFAYEVL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 31/69 (45%)
DUF3421 25..135 CDD:288732 61/109 (56%)
DM9 75..143 CDD:128937 41/68 (60%)
DM9 147..215 CDD:128937
DUF3421 166..276 CDD:288732
DM9 216..286 CDD:128937
CG31086NP_001247312.1 DM9 3..73 CDD:128937 31/70 (44%)
DUF3421 24..134 CDD:288732 61/109 (56%)
DM9 74..143 CDD:128937 41/68 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15731
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.