DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and CG16775

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster


Alignment Length:133 Identity:44/133 - (33%)
Similarity:64/133 - (48%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYG----GGEVVKHDYELL---AGYGYG 218
            ::||.|.||...||||..:..::|||:|:|..|.|  .|.    |.:..  .||:|   |..||.
  Fly    46 ILGGVDPDGYYTYVGRVTYSSNILPARVVPELGKA--TYNTDTLGNQAT--TYEVLVSNATVGYH 106

  Fly   219 WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVR-IDHYEV 282
            |:....|....|||..|..:..|.:||.|.....|:..|.::.|.....:.:|...:| .|.||:
  Fly   107 WIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNFPLRQFDKYEI 171

  Fly   283 LVK 285
            ||:
  Fly   172 LVR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937
DUF3421 25..135 CDD:288732
DM9 75..143 CDD:128937
DM9 147..215 CDD:128937 22/60 (37%)
DUF3421 166..276 CDD:288732 36/116 (31%)
DM9 216..286 CDD:128937 22/71 (31%)
CG16775NP_649022.2 DM9 29..100 CDD:128937 21/57 (37%)
DUF3421 51..164 CDD:288732 36/116 (31%)
DM9 104..175 CDD:128937 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.