DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and CG5506

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:67/163 - (41%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 AYEVLVQPET------WIASSGRGIVP-GTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCA 195
            ||.|   |.|      |.|.:...::| ..||||.|..|...||||..:...:|||:|:...|.|
  Fly    15 AYAV---PSTYDTEHVWKAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTA 76

  Fly   196 YVPYGGGEVVKHD---YELLAG---YGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSL 254
            |.   ..|.....   |::|..   ..|.||....|.....||..|.|...|.:|..||...|.:
  Fly    77 YF---NTETTSSKLLVYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGI 138

  Fly   255 TPGKIHQSHH--CLYIPFDGEEVR-IDHYEVLV 284
            ..|.:..|..  |: |..:...:| .|.|||||
  Fly   139 LIGTLLLSSQKVCI-IKHESLALRKFDKYEVLV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937
DUF3421 25..135 CDD:288732
DM9 75..143 CDD:128937 3/4 (75%)
DM9 147..215 CDD:128937 24/80 (30%)
DUF3421 166..276 CDD:288732 33/117 (28%)
DM9 216..286 CDD:128937 24/72 (33%)
CG5506NP_649021.1 DM9 25..96 CDD:128937 23/73 (32%)
DUF3421 47..161 CDD:288732 33/117 (28%)
DM9 100..172 CDD:128937 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.