DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and CG10916

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:136 Identity:57/136 - (41%)
Similarity:78/136 - (57%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPP-GAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKH----DFEVLVGD 74
            ||| ||:..|.:.|..|.:|.|.|::.::|||..||.|:.|:   |....|..    |.|:||.:
  Fly   122 LPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAF---GSHSCSARTLTDDVEILVLN 183

  Fly    75 --HFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLE 137
              .:.|:|...|:.|..|:..|.:..||..|.|||.:||.|..|||||||:.:|||:.|||..:.
  Fly   184 DCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVN 248

  Fly   138 AYEVLV 143
            .|||||
  Fly   249 TYEVLV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 23/62 (37%)
DUF3421 25..135 CDD:288732 46/115 (40%)
DM9 75..143 CDD:128937 31/67 (46%)
DM9 147..215 CDD:128937
DUF3421 166..276 CDD:288732
DM9 216..286 CDD:128937
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 24/63 (38%)
DUF3421 133..246 CDD:288732 46/115 (40%)
DM9 186..254 CDD:128937 31/67 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.