DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and CG44251

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster


Alignment Length:462 Identity:127/462 - (27%)
Similarity:184/462 - (39%) Gaps:180/462 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YTWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDF 68
            |.|:.::.|.|||..|::.|:|.|...|:||||.|.|:||..||||.||..::...|:.:.|..|
  Fly     3 YKWVQSSAYSSLPEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEALPKDIF 67

  Fly    69 EVLVGDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQE 133
            |||.|.:..||......:|.:|:..|:|...:|:|:|||:::|.|..||:...|:.|:|.:.|.|
  Fly    68 EVLCGQNLVWIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIGKISSVHRALFIAFRGAE 132

  Fly   134 HRLEAYEVLV-------------------QPE--------------------------------- 146
            .||::||:||                   :||                                 
  Fly   133 RRLDSYEILVEERRVVPGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMP 197

  Fly   147 ----------------------------------------------------------------- 146
                                                                             
  Fly   198 FPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSFTPA 262

  Fly   147 -------------------------------------------------------------TWI- 149
                                                                         .|: 
  Fly   263 EVAPPPSFVPAEVTAVSVPVAPSFTPASTYNPYEAGCSSYTPAECAAPSAYDAYGYGNNYDVWVS 327

  Fly   150 ASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAG 214
            |..|....|..|:||||::.:|:.|.|||:.|..:|.|.||::||.|:.:||.|:::..|::|.|
  Fly   328 AEPGYYYSPDAVIGGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGREIIEPSYQMLVG 392

  Fly   215 YG-YGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRID 278
            .| |.||....||||..||:.|.|..|.||:|||.|:.||||||.|...:.||.|||.|:|:|:.
  Fly   393 KGKYHWVPSYGGNVPPGAVVAGTTPGGAPLYIGRGHYCGSLTPGVIETYNRCLQIPFGGQEIRLS 457

  Fly   279 HYEVLVK 285
            :|||||:
  Fly   458 NYEVLVR 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 31/68 (46%)
DUF3421 25..135 CDD:288732 44/109 (40%)
DM9 75..143 CDD:128937 24/67 (36%)
DM9 147..215 CDD:128937 27/68 (40%)
DUF3421 166..276 CDD:288732 53/110 (48%)
DM9 216..286 CDD:128937 39/71 (55%)
CG44251NP_725246.1 DM9 3..73 CDD:128937 31/69 (45%)
DUF3421 24..134 CDD:288732 44/109 (40%)
DM9 74..144 CDD:128937 26/69 (38%)
DM9 322..393 CDD:128937 27/70 (39%)
DUF3421 344..455 CDD:288732 53/110 (48%)
DM9 396..464 CDD:128937 37/67 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15731
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D106292at50557
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.