DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and AgaP_AGAP009606

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_318634.4 Gene:AgaP_AGAP009606 / 1278979 VectorBaseID:AGAP009606 Length:297 Species:Anopheles gambiae


Alignment Length:279 Identity:86/279 - (30%)
Similarity:141/279 - (50%) Gaps:11/279 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLVGDHFS 77
            |.:||.|::||::.  :..::|||.|...::|.:|:|.|:...:...|.|.:.||::||.|....
Mosquito    11 GVVPPEAVVAGYEG--ETTYIGRAKHRKAIVPGRVIPSKKACLIVSEGLEHAVHDYQVLCGYDGR 73

  Fly    78 WIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVL 142
            ::.:|||..|..::|.|.|..|:|:::|..........|.:.|...|......|...|...||:.
Mosquito    74 FVQTSGGYCPIGSLQGGVTKRGKPIFIGLVRMGLVTVVGSIVPDEFCCQAVVNGILRRFNDYEIF 138

  Fly   143 VQPE-------TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYG 200
            ...|       .|:.::...:.|..||||:  :|:..::|||.|.|.::|.:::|:|....|.:|
Mosquito   139 GYTEHAYLDNARWVQAAEGLVPPDAVVGGY--EGEVTFIGRAKHRGSIVPGRIVPSKKACCVVWG 201

  Fly   201 GGEVVKHDYELLAGYGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHC 265
            |.|..|.||::|.||...:||...|.:|..|:..|.:..|:||:||......:...||:...|.|
Mosquito   202 GEEHTKSDYQVLCGYEGHFVHVGGGYIPNGALRGGVSEHGKPLYIGLVRLGSTTVVGKVQPEHSC 266

  Fly   266 LYIPFDGEEVRIDHYEVLV 284
            .||...|.|.....|:|.|
Mosquito   267 CYIAVGGVEKAFREYDVYV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 20/59 (34%)
DUF3421 25..135 CDD:288732 29/109 (27%)
DM9 75..143 CDD:128937 17/67 (25%)
DM9 147..215 CDD:128937 23/67 (34%)
DUF3421 166..276 CDD:288732 38/109 (35%)
DM9 216..286 CDD:128937 22/69 (32%)
AgaP_AGAP009606XP_318634.4 DM9 5..70 CDD:128937 20/60 (33%)
DUF3421 22..127 CDD:288732 28/106 (26%)
DM9 151..216 CDD:128937 23/66 (35%)
DUF3421 168..275 CDD:288732 37/108 (34%)
DM9 217..285 CDD:128937 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.