DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and AgaP_AGAP009604

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_318631.4 Gene:AgaP_AGAP009604 / 1278977 VectorBaseID:AGAP009604 Length:298 Species:Anopheles gambiae


Alignment Length:144 Identity:60/144 - (41%)
Similarity:88/144 - (61%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDYTWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKH 66
            |...|::. ..|.:||.|::.|  ||.:.:::|||.|.|.::|.|||......|:.|||.|..|.
Mosquito   158 GAACWVAA-ANGEIPPNAVVGG--SDGEDMYIGRAQHEGGIIPGKVVASHGVCYIAWGGAENPKA 219

  Fly    67 DFEVLVGDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGG 131
            ::|||......::|:||..:||.|:..|::.:||||::||...:|::|.|||.|||...||||||
Mosquito   220 EYEVLCDFGGEFVPASGSDIPPTALPAGESEDGEPLFIGRVTHEGTVTVGKVQPSHGVCYIPYGG 284

  Fly   132 QEHRLEAYEVLVQP 145
            ||.....||:.|.|
Mosquito   285 QELAFAEYEIFVSP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 26/69 (38%)
DUF3421 25..135 CDD:288732 49/109 (45%)
DM9 75..143 CDD:128937 31/67 (46%)
DM9 147..215 CDD:128937
DUF3421 166..276 CDD:288732
DM9 216..286 CDD:128937
AgaP_AGAP009604XP_318631.4 Methyltransf_FA 36..133 CDD:289052
DM9 161..225 CDD:128937 25/66 (38%)
DUF3421 179..288 CDD:288732 49/108 (45%)
DM9 228..297 CDD:128937 31/68 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.