DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13321 and AgaP_AGAP006195

DIOPT Version :9

Sequence 1:	NP_001286367.1	Gene:	CG13321 / 36430	FlyBaseID:	FBgn0033787	Length:	286	Species:	Drosophila melanogaster
Sequence 2:	XP_316260.4	Gene:	AgaP_AGAP006195 / 1276860	VectorBaseID:	AGAP006195	Length:	206	Species:	Anopheles gambiae

Alignment Length:	59	Identity:	10/59 - (16%)
Similarity:	21/59 - (35%)	Gaps:	14/59 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 SDQDPIFVGRAYHNGEML--------------PAKVVPGKQQAYVPWGGQEISKHDFEV 70
            :::..:|:...:|:|.:.              .||..|....|:..|....:..:|..|
Mosquito   132 ANRPTVFLVELFHDGTIQVRIEGQDYPFLLFNDAKKTPFNYMAFTKWNNDVVYFYDCPV 190

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13321	NP_001286367.1	DM9	3..73	CDD:128937	10/59 (17%)
		DUF3421	25..135	CDD:288732	10/59 (17%)
		DM9	75..143	CDD:128937
		DM9	147..215	CDD:128937
		DUF3421	166..276	CDD:288732
		DM9	216..286	CDD:128937
AgaP_AGAP006195	XP_316260.4	Methyltransf_FA	78..183	CDD:289052	8/50 (16%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910