DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13321 and AgaP_AGAP006195

DIOPT Version :9

Sequence 1:NP_001286367.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_316260.4 Gene:AgaP_AGAP006195 / 1276860 VectorBaseID:AGAP006195 Length:206 Species:Anopheles gambiae


Alignment Length:59 Identity:10/59 - (16%)
Similarity:21/59 - (35%) Gaps:14/59 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SDQDPIFVGRAYHNGEML--------------PAKVVPGKQQAYVPWGGQEISKHDFEV 70
            :::..:|:...:|:|.:.              .||..|....|:..|....:..:|..|
Mosquito   132 ANRPTVFLVELFHDGTIQVRIEGQDYPFLLFNDAKKTPFNYMAFTKWNNDVVYFYDCPV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13321NP_001286367.1 DM9 3..73 CDD:128937 10/59 (17%)
DUF3421 25..135 CDD:288732 10/59 (17%)
DM9 75..143 CDD:128937
DM9 147..215 CDD:128937
DUF3421 166..276 CDD:288732
DM9 216..286 CDD:128937
AgaP_AGAP006195XP_316260.4 Methyltransf_FA 78..183 CDD:289052 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.