DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44251 and CG31086

DIOPT Version :9

Sequence 1:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster


Alignment Length:127 Identity:52/127 - (40%)
Similarity:79/127 - (62%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 AVIGGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGREIIEPSYQMLVGKGKYHWVPSY 402
            ||:.||||:.:.:.:.||:|....:|.|.||::|..|:|:..:|:...:|::|.| ..|.|:|:.
  Fly    18 AVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVELENYEVLSG-FNYEWLPAE 81

  Fly   403 GGNVPPGAVVAGTTPGGAPLYIGRGHYCGSLTPGVIETYNRCLQIPFGGQEIRLSNYEVLVR 464
            .|.||||||..|....|..||.|||::.||||.|.:...:.||.||:..:|:::..||||.|
  Fly    82 NGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKIFAYEVLSR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732
DM9 74..144 CDD:128937
DM9 322..393 CDD:128937 19/54 (35%)
DUF3421 344..455 CDD:288732 43/110 (39%)
DM9 396..464 CDD:128937 31/67 (46%)
CG31086NP_001247312.1 DM9 3..73 CDD:128937 20/55 (36%)
DUF3421 24..134 CDD:288732 43/110 (39%)
DM9 74..143 CDD:128937 31/68 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15731
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1154851at2759
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.