DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44251 and CG16775

DIOPT Version :9

Sequence 1:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster


Alignment Length:150 Identity:52/150 - (34%)
Similarity:74/150 - (49%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KWVQSSAYSSLPEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEALPKD--I 66
            |||.......|||||::||.|.||...||||..:..::|..:|||  :||..:...:.|...  .
  Fly    31 KWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARVVP--ELGKATYNTDTLGNQATT 93

  Fly    67 FEVLCGQNLV---WIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIGKISSVHRALFIAF 128
            :|||.....|   ||:.:|....:|||..|..:|.:.|:|.|...:..:.||.:....|...:.:
  Fly    94 YEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYLSKRMCIVKY 158

  Fly   129 RGAE-RRLDSYEILVEERRV 147
            .... |:.|.|||||.||.|
  Fly   159 DNFPLRQFDKYEILVRERHV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937 27/70 (39%)
DUF3421 24..134 CDD:288732 32/115 (28%)
DM9 74..144 CDD:128937 22/73 (30%)
DM9 322..393 CDD:128937
DUF3421 344..455 CDD:288732
DM9 396..464 CDD:128937
CG16775NP_649022.2 DM9 29..100 CDD:128937 27/70 (39%)
DUF3421 51..164 CDD:288732 32/114 (28%)
DM9 104..175 CDD:128937 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.