DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44251 and CG5506

DIOPT Version :9

Sequence 1:NP_725246.1 Gene:CG44251 / 36429 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:151 Identity:40/151 - (26%)
Similarity:70/151 - (46%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WVQSSAYSSLPEEAVVGGNDEDGAMIYVGRAEHEGDMLVCKVVPSKQLGFISQRGEALPKDIFEV 69
            |...:....:|..|||||.|..|...||||.::...:|..:||......:.:....:....::::
  Fly    28 WKAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLLVYDI 92

  Fly    70 LCGQ---NLVWIKCYDHVIPENAVLCGRTSLDQPVYIGRGHYEGHLIIG-------KISSV-HRA 123
            |..:   |.||::.:|....:.||..|.|..::.|:..|...:|.::||       |:..: |.:
  Fly    93 LVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLSSQKVCIIKHES 157

  Fly   124 LFIAFRGAERRLDSYEILVEE 144
            |      |.|:.|.||:||.:
  Fly   158 L------ALRKFDKYEVLVAQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44251NP_725246.1 DM9 3..73 CDD:128937 17/67 (25%)
DUF3421 24..134 CDD:288732 27/120 (23%)
DM9 74..144 CDD:128937 23/77 (30%)
DM9 322..393 CDD:128937
DUF3421 344..455 CDD:288732
DM9 396..464 CDD:128937
CG5506NP_649021.1 DM9 25..96 CDD:128937 17/67 (25%)
DUF3421 47..161 CDD:288732 27/119 (23%)
DM9 100..172 CDD:128937 23/77 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.