DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdr49 and ABCI17

DIOPT Version :10

Sequence 1:NP_523724.2 Gene:Mdr49 / 36428 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_176961.1 Gene:ABCI17 / 843122 AraportID:AT1G67940 Length:263 Species:Arabidopsis thaliana


Alignment Length:209 Identity:79/209 - (37%)
Similarity:123/209 - (58%) Gaps:21/209 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 ILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVV 483
            ||||:|:|:..|..|..:|.||.||||.::.:.|.::|...:|.|||.|:..::|..||.::|::
plant    44 ILKGVTIDIPKGMIVGVIGPSGSGKSTFLRSLNRLWEPPESTVFLDGEDITNVDVIALRRRVGML 108

  Fly   484 GQEPVLFATTIGENIRYGRPS-----ATQADIEKAARAANCHDFITRLPKGYDTQVGEK-GAQIS 542
            .|.||||..|:.:|:||| |:     .:..::.|....|:           .|....:| ||::|
plant   109 FQLPVLFQGTVADNVRYG-PNLRGEKLSDEEVYKLLSLAD-----------LDASFAKKTGAELS 161

  Fly   543 GGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSAL-ELASQ-GPTTLVVAHRLSTITN- 604
            .||.||:|:||.|..:|:||||||.||||||.|.:.::..: :|..| |.||::|:|.:..|.. 
plant   162 VGQAQRVALARTLANEPEVLLLDEPTSALDPISTENIEDVIVKLKKQRGITTVIVSHSIKQIQKV 226

  Fly   605 ADKIVFLKDGVVAE 618
            ||.:..:.||.:.|
plant   227 ADIVCLVVDGEIVE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 44..643 CDD:440747 79/209 (38%)
MdlB 720..1299 CDD:440747
ABCI17NP_176961.1 ABC_PstB_phosphate_transporter 29..247 CDD:213227 79/209 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.