DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdr49 and ABCI11

DIOPT Version :10

Sequence 1:NP_523724.2 Gene:Mdr49 / 36428 FlyBaseID:FBgn0004512 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_196914.1 Gene:ABCI11 / 831259 AraportID:AT5G14100 Length:278 Species:Arabidopsis thaliana


Alignment Length:236 Identity:73/236 - (30%)
Similarity:116/236 - (49%) Gaps:30/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1035 FKRTSTQPNPPQSPYNTVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSG 1099
            |:||. :|......|:.:|..  |:.|...|.:      ..||.|:|.::::.:...:.|.||||
plant    35 FRRTK-KPRVISCDYSCIEVR--DVCYRPPGTQ------LNILNGVNFSLREKSFGLIFGKSGSG 90

  Fly  1100 KSTCVQLLLRYYDPVSGSVNLSGVPSTEFPL---DTL-RSKLGLVSQEPVLFDRTIAENIAYGNN 1160
            |:|.:|||.....|.|||:.:.|......|.   |.| ..|:|:|.|.|..|  .:|:|:.....
plant    91 KTTLLQLLAGLNKPTSGSICIQGYGDDGQPKADPDLLPTEKVGIVFQFPERF--FVADNVLDEIT 153

  Fly  1161 F---RDDVSMQEIIEAAKKSNIH---NFI--SALPQGYDTRLGKTSQLSGGQKQRIAIARALVRN 1217
            |   |...|:|  ::....||:.   |::  .::|...|.:|     ||||.|:|:|:|..||:.
plant   154 FGWPRQKGSLQ--LKEQLTSNLQRAFNWVGLDSIPLDKDPQL-----LSGGYKRRLALAIQLVQT 211

  Fly  1218 PKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRL 1258
            |.:|||||..:.||.::...|.:.|...:...|.|.::|.|
plant   212 PDLLILDEPLAGLDWKARADVAKLLKHLKKELTLLVVSHDL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdr49NP_523724.2 MdlB 44..643 CDD:440747
MdlB 720..1299 CDD:440747 73/236 (31%)
ABCI11NP_196914.1 ABC_cobalt_CbiO_domain1 52..268 CDD:213192 68/218 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.