DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sans and AT5G48680

DIOPT Version :9

Sequence 1:NP_610829.1 Gene:Sans / 36427 FlyBaseID:FBgn0033785 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_199679.2 Gene:AT5G48680 / 834926 AraportID:AT5G48680 Length:206 Species:Arabidopsis thaliana


Alignment Length:302 Identity:62/302 - (20%)
Similarity:98/302 - (32%) Gaps:106/302 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FSDLVGNGSSSS--------GGSTIASRAGTVQKRPSQLQKQHSSTCPHSKISSDTDGGFKVREV 265
            :||||...:..|        |||...|..|..|:...:..:|......|.....|.:.....|.|
plant     2 YSDLVVAETKISKTFKNRLNGGSGDFSSRGKQQQVTRKRGRQDDDKWEHDLFEDDDEPRLSKRRV 66

  Fly   266 EPDGKRTITSLTGLQRDSEVLYVGTFSSNEDSVGKRGKISDVFECMEADELDHSDNRSGYSSTLA 330
            :|...|     ..||:          ..:...:|.|     ||....||                
plant    67 DPKDLR-----LKLQK----------KRHGSQIGGR-----VFSVSVAD---------------- 95

  Fly   331 RSFSQPDILGDGQLTQELSEEVTLQRPVGLFDRPTMLGSIAFRRSVTAALSQLQLHTDTSSTSTM 395
                         |..:||..|..|.            ..:.|.:|..|:.::.:.|        
plant    96 -------------LRDKLSRTVNPQT------------KNSKREAVRPAIKKVSVGT-------- 127

  Fly   396 RNAGSNPPKTRNGGGKGRLYLNLSDDTDSEGGGHDIYSDDDDDDRDAGGSALQRFLAVWALEEYL 460
                  .|:||....:.                    :..|....||   ::..||....||:|.
plant   128 ------KPETRAAPNRA--------------------TKKDPQQNDA---SVDSFLESLGLEKYS 163

  Fly   461 PVFQKQEIDLETLMLLTESDLKSLGLPLGPFRKLTFAIQERR 502
            ..||.:|:|::.|..:|:.|||:|.:|:||.:|:..|:.:.|
plant   164 TAFQVEEVDMDALRHMTDDDLKALLIPMGPRKKILLALGDNR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SansNP_610829.1 ANK 6..118 CDD:238125
Ank_2 6..96 CDD:289560
ANK repeat 35..63 CDD:293786
ANK repeat 65..96 CDD:293786
Ank_2 70..149 CDD:289560
SAM_USH1G_HARP 443..508 CDD:188916 21/60 (35%)
SAM 447..503 CDD:197735 21/56 (38%)
AT5G48680NP_199679.2 SAM_superfamily 149..201 CDD:188886 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I4486
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002068
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.