DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17019 and APD3

DIOPT Version :9

Sequence 1:NP_001286365.1 Gene:CG17019 / 36425 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_181357.2 Gene:APD3 / 818401 AraportID:AT2G38220 Length:404 Species:Arabidopsis thaliana


Alignment Length:382 Identity:89/382 - (23%)
Similarity:146/382 - (38%) Gaps:72/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 EAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQALNVNQRPANPSPAFYPAVPQRTKKVT 414
            |.|...|.:|...:...:.::|....|.|.|:.|......|   ..:.||..|......|...|:
plant    64 ETVWLGPNSSILVKPSSIFVKSIKVKELDFSKPGLQLYGFN---GQSTPSGYFVNWTESRVLSVS 125

  Fly   415 RRRSDG---YLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHPEHGLHPHSHRQSCQRCGKNKT-- 474
            :....|   ||||..|.:...: :.|.|..:.|.::..|:  ..|: |..:|.|.:......|  
plant   126 QNSYKGWPYYLNRGTHMNISYN-ILPKGSAVRLVITEGSQ--VIGM-PFFYRSSLKDIAFRDTAW 186

  Fly   475 --NIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDAS-DADSHAV----SPLSVDA 532
              |:          ::.|.|.:.||.:....:||....:.|.::.. |.|..||    ...|.:.
plant   187 SWNL----------IQGSGMIQLDISKSKGYYLTVANLKRKDIEVELDIDVKAVLYDTKQTSYNC 241

  Fly   533 ISVAAGGRSPDM----PI-TPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGIDSRFVNLED 592
             |.:.|..|..|    |: ...:..||...:.:..||:..|.:     .::|      |.:....
plant   242 -SFSNGECSFKMNERYPVENYAVVTSPALGQGVSIDDEWYIEL-----SYQP------RLIAYGS 294

  Fly   593 FEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKLATD------- 650
            |      .|:.:..:  ::.:|..:...||..:..|....    ::|.|...:|...|       
plant   295 F------TGVLLSFM--LVAIHFCNKLKCCGGEGFLSGDD----SVRTCLLADKGDNDCCNDVEA 347

  Fly   651 ---ELCKICMDAPIECVFLECGHMATCTSCG----KVLNECPICRQYIVRVVRFFRA 700
               .||.||.|||.:|.||.|||..:|..||    :....|||||:.::.|.|.:.|
plant   348 SNKSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKMIHVKRIYTA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 22/57 (39%)
APD3NP_181357.2 DUF4792 98..164 CDD:374322 15/69 (22%)
DUF4793 196..306 CDD:374323 25/129 (19%)
zf-C3HC4_3 349..394 CDD:372816 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4202
eggNOG 1 0.900 - - E1_KOG4275
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1361306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3123
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.