DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and CMR3

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:59/295 - (20%)
Similarity:104/295 - (35%) Gaps:94/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NSGPHSRGIYE------PPLGYFTP---YNTPPYIAA----------------------YSD-SG 42
            ||..:.|..|.      ||:....|   .||||.:.:                      |:. |.
Yeast    58 NSYKNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPISM 122

  Fly    43 SWLADHHQHHQQQHQQ---HQQQMQHIRFPTP---PITPP---RPIAGYGYRQRTQSVIMKARGQ 98
            :..:|.:..:..:.||   |.|. .|:....|   |:..|   :|:..|.               
Yeast   123 NATSDQYPIYYTESQQPIPHSQS-PHLTSSAPLMMPVMVPTVYKPLTPYD--------------- 171

  Fly    99 QDELCRSPVEFPDDSK--SCSSSSECGTASDFVCNWTDCDR---------VFDTLDALAQHVTQR 152
                 :.|:....:..  :.|.:|....|.: :|:    ||         |..|:...:...|:.
Yeast   172 -----KEPITIASEPNFTAISMASHPNAALE-LCH----DRPKSVPPGYGVLPTMQEASNGRTKS 226

  Fly   153 HAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRS 217
            ...|.|.....:..|:                ..||..:.:...:|.:|.|..||...||.|...
Yeast   227 EPGAVLNGSATFSDWK----------------TDTRISSTKLRKQCPVCGKICSRPSTLKTHYLI 275

  Fly   218 HSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEK 252
            |:|:.|:||::|||.|:::..|:..:|.::|..::
Yeast   276 HTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 2/19 (11%)
zf-H2C2_2 183..207 CDD:290200 5/23 (22%)
COG5048 192..>271 CDD:227381 20/61 (33%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
zf-H2C2_2 210..237 CDD:290200 12/26 (46%)
C2H2 Zn finger 226..248 CDD:275368 7/21 (33%)
C2H2 Zn finger 256..277 CDD:275368
CMR3NP_015338.1 COG5048 17..316 CDD:227381 59/295 (20%)
C2H2 Zn finger 256..276 CDD:275370 8/19 (42%)
C2H2 Zn finger 284..306 CDD:275370 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.