Sequence 1: | NP_610826.1 | Gene: | sug / 36424 | FlyBaseID: | FBgn0033782 | Length: | 384 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003404.1 | Gene: | ZIC3 / 7547 | HGNCID: | 12874 | Length: | 467 | Species: | Homo sapiens |
Alignment Length: | 421 | Identity: | 122/421 - (28%) |
---|---|---|---|
Similarity: | 169/421 - (40%) | Gaps: | 130/421 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 AAYSDSGSWLAD--HHQHHQQQHQQHQQQM----------------------------------Q 64
Fly 65 HIRF-------------PTPP---ITPPRPIAGYGYRQRT-----QSVIMKARGQ---------- 98
Fly 99 ----QDELCRSPVEFPDDS-----KSCSSSSECGTASDF-----------VCNWTD--------- 134
Fly 135 -CDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRC 198
Fly 199 HL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGC 261
Fly 262 QKRYTDPSSLRKHVKTFKHSIHLIASQPLTLPSVPCLLEASSESAFTCLPAASS--VESTSSSSS 324
Fly 325 ARYYDDSNNEPSDYSLKPKQDAEFSPSY--W 353 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sug | NP_610826.1 | C2H2 Zn finger | 170..190 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 183..207 | CDD:290200 | 11/25 (44%) | ||
COG5048 | 192..>271 | CDD:227381 | 46/80 (58%) | ||
C2H2 Zn finger | 198..218 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 210..237 | CDD:290200 | 17/26 (65%) | ||
C2H2 Zn finger | 226..248 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 256..277 | CDD:275368 | 14/20 (70%) | ||
ZIC3 | NP_003404.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 66..107 | 10/34 (29%) | |
Nuclear localization signal | 297..322 | 10/24 (42%) | |||
C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
SFP1 | <324..408 | CDD:227516 | 51/85 (60%) | ||
C2H2 Zn finger | 330..352 | CDD:275368 | 12/21 (57%) | ||
Nuclear localization signal | 330..352 | 12/21 (57%) | |||
C2H2 Zn finger | 360..382 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 15/26 (58%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 404..467 | 21/86 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X217 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |