DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and zic3

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001001950.1 Gene:zic3 / 368263 ZFINID:ZDB-GENE-030708-2 Length:448 Species:Danio rerio


Alignment Length:211 Identity:87/211 - (41%)
Similarity:118/211 - (55%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CNWTD----------CDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKML 184
            |.|.|          |||.|.|:..:..||:..| :.......:.|.|..|.|..:.|.|:||::
Zfish   233 CKWIDENQMNRPKKTCDRTFSTMHEMVTHVSMEH-VGGPEQSNHVCYWEDCPREGKSFKAKYKLV 296

  Fly   185 VHTRTHTKEKPHRCHL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRT 247
            .|.|.||.|||..|..  |.|.|:|:||||||.|:|:||||:||.|:||.:.::|||||.||...
Zfish   297 NHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHV 361

  Fly   248 HSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQPLT-----LPSVPCLLEASSESAF 307
            |:.:|||:|||  |.|.||.|||||||:|.  |......|.|..     ..:.|.|:.|::|.. 
Zfish   362 HTSDKPYICKV--CDKSYTHPSSLRKHMKV--HESQGSESSPAASSGYESSTPPVLVSANTEDP- 421

  Fly   308 TCLPAASSVESTSSSS 323
            |..| .|:|:::|:.|
Zfish   422 TKTP-TSAVQNSSAHS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 8/19 (42%)
zf-H2C2_2 183..207 CDD:290200 11/25 (44%)
COG5048 192..>271 CDD:227381 45/80 (56%)
C2H2 Zn finger 198..218 CDD:275368 12/21 (57%)
zf-H2C2_2 210..237 CDD:290200 16/26 (62%)
C2H2 Zn finger 226..248 CDD:275368 11/21 (52%)
C2H2 Zn finger 256..277 CDD:275368 14/20 (70%)
zic3NP_001001950.1 C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..321 CDD:290200 11/25 (44%)
C2H2 Zn finger 310..332 CDD:275368 12/21 (57%)
zf-H2C2_2 324..351 CDD:290200 16/26 (62%)
C2H2 Zn finger 340..362 CDD:275368 11/21 (52%)
zf-H2C2_2 354..379 CDD:290200 14/26 (54%)
zf-C2H2 368..390 CDD:278523 16/25 (64%)
C2H2 Zn finger 370..390 CDD:275368 15/23 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.