DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and Zic5

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001382593.1 Gene:Zic5 / 361095 RGDID:1310160 Length:623 Species:Rattus norvegicus


Alignment Length:330 Identity:107/330 - (32%)
Similarity:142/330 - (43%) Gaps:78/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AAYSDSGSWLADHHQHHQQQHQQHQQQMQHIRFPTPPITPPRPIAGYGYRQRTQSVIMKARGQQD 100
            ||.:.:.:....|.|||                ..||..||.| |.:.:...    :..|.|...
  Rat   313 AAAAAAAAGPGPHLQHH----------------APPPAPPPAP-APHPHHPH----LPGAAGAFL 356

  Fly   101 ELCRSPVEFPDDSKSCSSSSECGTASDFVCNWTD-----------------CDRVFDTLDALAQH 148
            ...|.|::                 .:.:|.|.|                 |.:.|.|:..|..|
  Rat   357 RYMRQPIK-----------------RELICKWLDPEELAGPPAPADSGAKPCSKTFGTMHELVNH 404

  Fly   149 VTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL--CEKSFSRAENL 211
            ||..| :.......:.|.|..|.|..:.|.|:||::.|.|.||.|||..|..  |.|.|:|:|||
  Rat   405 VTVEH-VGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENL 468

  Fly   212 KIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVK 276
            |||.|:|:||||:||.|:||.:.::|||||.||:..|:.:|||.||:.||.|.||.|||||||:|
  Rat   469 KIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDKSYTHPSSLRKHMK 533

  Fly   277 TFKHSIHLIASQPLTLPSVPCLLEASSES---AFTCLPAASSVESTSSSSSAR-------YYDDS 331
                 ||  ...|   |..|..|..||..   ..|..|......|.||:.|.:       |...:
  Rat   534 -----IH--CKSP---PPSPGALGYSSVGTPVGDTLSPVLDPTRSRSSTLSPQVTNLNEWYVCQA 588

  Fly   332 NNEPS 336
            ...||
  Rat   589 GGAPS 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 8/19 (42%)
zf-H2C2_2 183..207 CDD:290200 11/25 (44%)
COG5048 192..>271 CDD:227381 45/80 (56%)
C2H2 Zn finger 198..218 CDD:275368 12/21 (57%)
zf-H2C2_2 210..237 CDD:290200 16/26 (62%)
C2H2 Zn finger 226..248 CDD:275368 11/21 (52%)
C2H2 Zn finger 256..277 CDD:275368 14/20 (70%)
Zic5NP_001382593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X217
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.