DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and iec1

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_594663.1 Gene:iec1 / 2542854 PomBaseID:SPAC144.02 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:35/129 - (27%)
Similarity:60/129 - (46%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SPVEFPDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVTQRHA--------IASLTDG 161
            ||::...:|::             :|:|..|::...|||.|..|:.....        |.|:.|.
pombe    14 SPIDLEPESET-------------ICHWQSCEQDLLTLDNLVHHIHNGTTSNLRLISNINSILDH 65

  Fly   162 L------YYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL--CEKSFSRAENLKIHIRS 217
            :      |.|.|..|.|......:|:.::.|.|:||.|||..|.:  |::||:|::.|..|:|:
pombe    66 IGNRRPKYTCEWDDCPRKGMVQTSRFALVAHLRSHTGEKPFICSVPECDRSFTRSDALAKHMRT 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 5/19 (26%)
zf-H2C2_2 183..207 CDD:290200 11/25 (44%)
COG5048 192..>271 CDD:227381 11/28 (39%)
C2H2 Zn finger 198..218 CDD:275368 8/22 (36%)
zf-H2C2_2 210..237 CDD:290200 3/8 (38%)
C2H2 Zn finger 226..248 CDD:275368
C2H2 Zn finger 256..277 CDD:275368
iec1NP_594663.1 COG5048 1..>249 CDD:227381 35/129 (27%)
zf-H2C2_2 92..119 CDD:290200 11/26 (42%)
C2H2 Zn finger 108..129 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.