Sequence 1: | NP_610826.1 | Gene: | sug / 36424 | FlyBaseID: | FBgn0033782 | Length: | 384 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033601.2 | Gene: | Zic3 / 22773 | MGIID: | 106676 | Length: | 466 | Species: | Mus musculus |
Alignment Length: | 422 | Identity: | 122/422 - (28%) |
---|---|---|---|
Similarity: | 170/422 - (40%) | Gaps: | 133/422 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 AAYSDSGSWLAD---HHQHHQQQHQQHQQQM---------------------------------- 63
Fly 64 QHIRF-------------PTPP---ITPPRPIAGYGYRQRT-----QSVIMKARGQ--------- 98
Fly 99 -----QDELCRSPVEFPDDS-----KSCSSSSECGTASDF-----------VCNWTD-------- 134
Fly 135 --CDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHR 197
Fly 198 CHL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAG 260
Fly 261 CQKRYTDPSSLRKHVKTFKHSIHLIASQPLTLPSVPCLLEASSESAFTCLPAASS--VESTSSSS 323
Fly 324 SARYYDDSNNEPSDYSLKPKQDAEFSPSY--W 353 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sug | NP_610826.1 | C2H2 Zn finger | 170..190 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 183..207 | CDD:290200 | 11/25 (44%) | ||
COG5048 | 192..>271 | CDD:227381 | 46/80 (58%) | ||
C2H2 Zn finger | 198..218 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 210..237 | CDD:290200 | 17/26 (65%) | ||
C2H2 Zn finger | 226..248 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 256..277 | CDD:275368 | 14/20 (70%) | ||
Zic3 | NP_033601.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 65..103 | 11/32 (34%) | |
Nuclear localization signal. /evidence=ECO:0000250 | 296..321 | 10/24 (42%) | |||
C2H2 Zn finger | 301..321 | CDD:275368 | 8/19 (42%) | ||
SFP1 | <323..407 | CDD:227516 | 51/85 (60%) | ||
C2H2 Zn finger | 329..351 | CDD:275368 | 12/21 (57%) | ||
Nuclear localization signal. /evidence=ECO:0000250 | 329..351 | 12/21 (57%) | |||
C2H2 Zn finger | 359..381 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 15/26 (58%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 403..466 | 21/86 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X217 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |