DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and GLIS1

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001377765.1 Gene:GLIS1 / 148979 HGNCID:29525 Length:803 Species:Homo sapiens


Alignment Length:237 Identity:99/237 - (41%)
Similarity:124/237 - (52%) Gaps:55/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HQQQMQHIRFPTP-PIT--PPRP-IAGYGYRQRTQSVIMKARGQQDELCRSPVEFPDDSKSCSSS 119
            |||.:     |.| |::  ||.| :.|.|.....:.|    .|:|                    
Human   335 HQQGL-----PPPYPLSQLPPGPSLGGLGLGLAGRVV----AGRQ-------------------- 370

  Fly   120 SECGTASDFVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKML 184
                     .|.|.||...::..:.|.:|:.:.| |.......:.|.|.||.|..:.||||||:|
Human   371 ---------ACRWVDCCAAYEQQEELVRHIEKSH-IDQRKGEDFTCFWAGCVRRYKPFNARYKLL 425

  Fly   185 VHTRTHTKEKPHRC----------HLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSS 239
            :|.|.|:.|||::|          ..|.|:|||.||||||:|||:|||||.|...|||||:||||
Human   426 IHMRVHSGEKPNKCMPFPQFFHEFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSS 490

  Fly   240 DRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHS 281
            ||.||.|||...|||.|::.||.||||||||||||||.  ||
Human   491 DRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKA--HS 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 11/19 (58%)
zf-H2C2_2 183..207 CDD:290200 11/33 (33%)
COG5048 192..>271 CDD:227381 53/88 (60%)
C2H2 Zn finger 198..218 CDD:275368 13/29 (45%)
zf-H2C2_2 210..237 CDD:290200 19/26 (73%)
C2H2 Zn finger 226..248 CDD:275368 15/21 (71%)
C2H2 Zn finger 256..277 CDD:275368 16/20 (80%)
GLIS1NP_001377765.1 C2H2 Zn finger 376..395 CDD:275368 4/18 (22%)
C2H2 Zn finger 406..431 CDD:275368 14/24 (58%)
COG5048 447..>522 CDD:227381 49/74 (66%)
C2H2 Zn finger 450..469 CDD:275368 12/18 (67%)
C2H2 Zn finger 477..499 CDD:275368 15/21 (71%)
C2H2 Zn finger 507..529 CDD:275368 17/23 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.