DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and glis2b

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001276814.1 Gene:glis2b / 102725539 ZFINID:ZDB-GENE-091204-120 Length:489 Species:Danio rerio


Alignment Length:173 Identity:101/173 - (58%)
Similarity:116/173 - (67%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSE 174
            |.|::   :|.:........|.|..|..:||:|..|..||...| :....|..|.|.|.||.|..
Zfish   147 PKDTR---ASPDLSADEQLACRWRKCHLLFDSLQDLVDHVNDFH-VKPEKDSGYCCHWEGCARKG 207

  Fly   175 RGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSS 239
            ||||||||||:|.||||.||||||..|.|||||.||||||.|||:|||||.|.:|||.|.|||||
Zfish   208 RGFNARYKMLIHIRTHTNEKPHRCPTCNKSFSRLENLKIHNRSHTGEKPYICPYEGCNKRYSNSS 272

  Fly   240 DRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSI 282
            |||||||||.::|||.||:.||.||||||||||||:|...|.:
Zfish   273 DRFKHTRTHYVDKPYYCKMVGCLKRYTDPSSLRKHIKAHGHFV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 14/19 (74%)
zf-H2C2_2 183..207 CDD:290200 17/23 (74%)
COG5048 192..>271 CDD:227381 59/78 (76%)
C2H2 Zn finger 198..218 CDD:275368 14/19 (74%)
zf-H2C2_2 210..237 CDD:290200 19/26 (73%)
C2H2 Zn finger 226..248 CDD:275368 17/21 (81%)
C2H2 Zn finger 256..277 CDD:275368 16/20 (80%)
glis2bNP_001276814.1 C2H2 Zn finger 207..223 CDD:275368 12/15 (80%)
zf-H2C2_2 219..240 CDD:290200 15/20 (75%)
COG5048 227..>304 CDD:227381 58/76 (76%)
C2H2 Zn finger 231..251 CDD:275368 14/19 (74%)
zf-H2C2_2 243..270 CDD:290200 19/26 (73%)
C2H2 Zn finger 259..281 CDD:275368 17/21 (81%)
C2H2 Zn finger 289..311 CDD:275368 17/21 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006993
OrthoInspector 1 1.000 - - otm25770
orthoMCL 1 0.900 - - OOG6_109933
Panther 1 1.100 - - LDO PTHR19818
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.