DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sug and glis2

DIOPT Version :9

Sequence 1:NP_610826.1 Gene:sug / 36424 FlyBaseID:FBgn0033782 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_002932507.2 Gene:glis2 / 100492770 XenbaseID:XB-GENE-12564475 Length:493 Species:Xenopus tropicalis


Alignment Length:247 Identity:116/247 - (46%)
Similarity:133/247 - (53%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PVEFPDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGC 170
            |..|....|....|.|.......||.|..|:|:|:.|..|..||...| :....|..|.|.|.||
 Frog   137 PSMFMSPPKEKRLSLEYTEQKQLVCQWAKCNRLFELLQELVDHVNDFH-VKPEKDAGYCCHWEGC 200

  Fly   171 QRSERGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAY 235
            .|..||||||||||:|.||||.|:||.|..|.|||||.||||||.|||:|||||.|.:|||.|.|
 Frog   201 ARRGRGFNARYKMLIHIRTHTNERPHCCPTCHKSFSRLENLKIHNRSHTGEKPYMCPYEGCNKRY 265

  Fly   236 SNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKH----------SIH------- 283
            |||||||||||||.::|||.||:.|||||||||||||||:|...|          .||       
 Frog   266 SNSSDRFKHTRTHYVDKPYYCKMPGCQKRYTDPSSLRKHIKAHGHFISHQQRQLLKIHQPPKLPV 330

  Fly   284 -------------------LIASQPLTLPSVPCLLEASSESAFTCLPAASSV 316
                               :..||.|.:|..|..|:.||   ..|...||::
 Frog   331 TGDSSYTNGTQLIIPNPAAIFGSQSLPIPLTPGPLDLSS---LACSGMASAL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sugNP_610826.1 C2H2 Zn finger 170..190 CDD:275368 14/19 (74%)
zf-H2C2_2 183..207 CDD:290200 15/23 (65%)
COG5048 192..>271 CDD:227381 58/78 (74%)
C2H2 Zn finger 198..218 CDD:275368 14/19 (74%)
zf-H2C2_2 210..237 CDD:290200 19/26 (73%)
C2H2 Zn finger 226..248 CDD:275368 17/21 (81%)
C2H2 Zn finger 256..277 CDD:275368 17/20 (85%)
glis2XP_002932507.2 C2H2 Zn finger 204..220 CDD:275368 12/15 (80%)
COG5048 224..>301 CDD:227381 57/76 (75%)
C2H2 Zn finger 228..248 CDD:275368 14/19 (74%)
C2H2 Zn finger 256..278 CDD:275368 17/21 (81%)
C2H2 Zn finger 286..308 CDD:275368 18/21 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006993
OrthoInspector 1 1.000 - - oto104861
Panther 1 1.100 - - LDO PTHR19818
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.