DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13319 and AT1G48170

DIOPT Version :9

Sequence 1:NP_001163131.1 Gene:CG13319 / 36423 FlyBaseID:FBgn0033781 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_564522.1 Gene:AT1G48170 / 841236 AraportID:AT1G48170 Length:153 Species:Arabidopsis thaliana


Alignment Length:102 Identity:21/102 - (20%)
Similarity:41/102 - (40%) Gaps:28/102 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EVFEELAV--------------------------AMPSRNPASSQSLSSTILGGHGQTDSSVLAA 90
            |||:::.:                          |..|..|:::.|::| :|||......|.:|.
plant    41 EVFDDVTIQFQIIRLAKQIYVWVGCNSAKFGSLYAAASTRPSNTVSVTS-VLGGTSDNTGSGIAR 104

  Fly    91 KLSKRYCRQFYVSLNL-KLDRLMGPLFEKTLVTYMQD 126
            :|..:......::.|: |.:.|:....||.|:..:.|
plant   105 RLVLKTGLNIILACNIPKNNPLLEAKAEKVLIRKLID 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13319NP_001163131.1 PAC4 36..106 CDD:292711 14/79 (18%)
AT1G48170NP_564522.1 PAC4 52..120 CDD:406487 11/68 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105203
Panther 1 1.100 - - LDO PTHR33559
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.