DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13319 and Psmg4

DIOPT Version :10

Sequence 1:NP_610825.2 Gene:CG13319 / 36423 FlyBaseID:FBgn0033781 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001123351.1 Gene:Psmg4 / 689623 RGDID:1589955 Length:121 Species:Rattus norvegicus


Alignment Length:76 Identity:25/76 - (32%)
Similarity:38/76 - (50%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKLSKRYCRQFYVSLNL-KLDRLMGPLFEKTL 120
            |||||.||  ..|..:.:::.|....|.|:.||.:|:::..:|.:||.|| ..|.....|.|..:
  Rat    48 LAVAMCSR--FDSIPVCTSLFGDTSDTTSTGLAQRLARKTSKQVFVSYNLSNTDSNFTLLVENRI 110

  Fly   121 VTYMQDHLEHF 131
            ...|:...|.|
  Rat   111 KEEMETFPEKF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13319NP_610825.2 PAC4 36..106 CDD:465017 17/48 (35%)
Psmg4NP_001123351.1 PAC4 28..95 CDD:465017 17/48 (35%)

Return to query results.
Submit another query.