powered by:
Protein Alignment CG13319 and PSMG4
DIOPT Version :9
Sequence 1: | NP_001163131.1 |
Gene: | CG13319 / 36423 |
FlyBaseID: | FBgn0033781 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122064.1 |
Gene: | PSMG4 / 389362 |
HGNCID: | 21108 |
Length: | 162 |
Species: | Homo sapiens |
Alignment Length: | 115 |
Identity: | 27/115 - (23%) |
Similarity: | 41/115 - (35%) |
Gaps: | 42/115 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 LAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKL----------------------------- 92
|||||.|| ..|..:|:::||....|.|:.||.:|
Human 50 LAVAMCSR--YDSIPVSTSLLGDTSDTTSTGLAQRLGLGGKTGLACECGVEWGLSKGHEAECSTL 112
Fly 93 ----------SKRYCRQFYVSLNLK-LDRLMGPLFEKTLVTYMQDHLEHF 131
:::..:|.:||.||: .|.....|.|..:...|:...|.|
Human 113 PTPQHTSCGPARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF 162
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13319 | NP_001163131.1 |
PAC4 |
36..106 |
CDD:292711 |
19/87 (22%) |
PSMG4 | NP_001122064.1 |
PAC4 |
30..136 |
CDD:292711 |
19/87 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C76C |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105203 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR33559 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.900 |
|
Return to query results.
Submit another query.