DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13319 and PSMG4

DIOPT Version :9

Sequence 1:NP_001163131.1 Gene:CG13319 / 36423 FlyBaseID:FBgn0033781 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001122064.1 Gene:PSMG4 / 389362 HGNCID:21108 Length:162 Species:Homo sapiens


Alignment Length:115 Identity:27/115 - (23%)
Similarity:41/115 - (35%) Gaps:42/115 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKL----------------------------- 92
            |||||.||  ..|..:|:::||....|.|:.||.:|                             
Human    50 LAVAMCSR--YDSIPVSTSLLGDTSDTTSTGLAQRLGLGGKTGLACECGVEWGLSKGHEAECSTL 112

  Fly    93 ----------SKRYCRQFYVSLNLK-LDRLMGPLFEKTLVTYMQDHLEHF 131
                      :::..:|.:||.||: .|.....|.|..:...|:...|.|
Human   113 PTPQHTSCGPARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13319NP_001163131.1 PAC4 36..106 CDD:292711 19/87 (22%)
PSMG4NP_001122064.1 PAC4 30..136 CDD:292711 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C76C
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105203
Panther 1 1.100 - - LDO PTHR33559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.