DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13319 and psmg4

DIOPT Version :9

Sequence 1:NP_001163131.1 Gene:CG13319 / 36423 FlyBaseID:FBgn0033781 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001373285.1 Gene:psmg4 / 100333944 ZFINID:ZDB-GENE-121003-4 Length:131 Species:Danio rerio


Alignment Length:97 Identity:30/97 - (30%)
Similarity:49/97 - (50%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKMQGSTMLIINPKGLEVFEELAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKLSKRYCRQF 100
            :|:.|...|.:......:...|||::.||  ..|..||:.:||....|.:|.||.:|:|:..:|.
Zfish    37 MKLSGGFFLWVGTATNPLISNLAVSILSR--TDSAPLSTLVLGDTSDTTASALAQRLTKKTKKQV 99

  Fly   101 YVSLNLKL-DRLMGPLFEKTLVTYMQDHLEHF 131
            :||.||.: |..:..|.|..:...|:.|.:.|
Zfish   100 FVSYNLPVTDSNLLLLVENRIKQEMELHPDKF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13319NP_001163131.1 PAC4 36..106 CDD:292711 22/69 (32%)
psmg4NP_001373285.1 PAC4 36..105 CDD:406487 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105203
Panther 1 1.100 - - LDO PTHR33559
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.