DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vg and vgll3

DIOPT Version :9

Sequence 1:NP_523723.1 Gene:vg / 36421 FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001072251.1 Gene:vgll3 / 779704 XenbaseID:XB-GENE-5865239 Length:244 Species:Xenopus tropicalis


Alignment Length:178 Identity:55/178 - (30%)
Similarity:75/178 - (42%) Gaps:52/178 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 QAQYLSASCVVFTNYSGDTASQVDEHFSRALN----YNNKDS------------KESSSPMSNRN 328
            :.:||::.||:||.:.||..:.|||||||||:    :|.:.:            |||.|....:|
 Frog    17 EMEYLNSRCVLFTYFQGDIGAVVDEHFSRALSQISTFNPESTASKSKLGSNSLWKESPSASCQKN 81

  Fly   329 -FPPSFWNSNYVHPIP------------APTHHQVSDLYGTATDTGYATDPWVPHAA----HYG- 375
             ||.|.|.::|..|.|            ||:....:|......:|.:.|.|..|.||    ||. 
 Frog    82 SFPSSLWTNSYQAPTPPCLSGVHPDFSAAPSTFSSTDHTSWRGETLHQTIPPPPPAASESWHYPL 146

  Fly   376 ---------------SYAHAAHAHAAHAHAYH---HNMAQYGSLLRLP 405
                           .|.|.||.|..|.|.:|   |...:||.||..|
 Frog   147 VSQASSPYTHMHDVYMYHHHAHPHTHHHHHHHPSSHLDPRYGHLLMPP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 17/33 (52%)
vgll3NP_001072251.1 Vg_Tdu 19..49 CDD:311481 17/29 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4594
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48647
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7863
SonicParanoid 1 1.000 - - X2352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.