DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vg and vgll2b

DIOPT Version :9

Sequence 1:NP_523723.1 Gene:vg / 36421 FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001028267.1 Gene:vgll2b / 606659 ZFINID:ZDB-GENE-050809-113 Length:288 Species:Danio rerio


Alignment Length:287 Identity:85/287 - (29%)
Similarity:115/287 - (40%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 HNESSCSSGPDSPRHAHSHSHPLHGGGGATGGPSSAGGTGSGGGDGGGTGAIPKNLPALETPMGS 268
            |..|:..|...:|....|.|........:.|....:...||....|..|...|        |.|.
Zfish    19 HKASAFISTLPAPLGLRSPSSRCRDPMDSAGALCCSDNAGSSSSAGPSTSPYP--------PSGQ 75

  Fly   269 GGGGLAGSGQGQAQYLSASCVVFTNYSGDTASQVDEHFSRALN-YNNKDSKE-----SSSPMSN- 326
            ..........|:|:|||:.||:||.|.||.:|.|||||||||: |...:.|:     |:.|:|: 
Zfish    76 VEEATKDKEVGEAEYLSSRCVLFTYYQGDISSVVDEHFSRALSTYMEAEGKKRASDPSTDPLSSS 140

  Fly   327 --RNFPPSFWNSNYVHPIPAPTHHQVSDLYGTATDTGYATDPWVPHAAHYGSYAHAAHAHAAHAH 389
              |:||||||:|||    |:|......|..|..|   ||.||: ....|.|......|.|.:.:.
Zfish   141 SRRSFPPSFWDSNY----PSPPSRPHCDPTGAPT---YAIDPY-SQGLHPGLPHTHPHPHPSESW 197

  Fly   390 AYHHNMAQYGSLLRLPQQYASHGSRLHHDQQTAHALEYSSYPTMAG------LE----------- 437
            .|..:.| |.:...|.:.|:..|...|:......|:.....||:.|      ||           
Zfish   198 TYSQSQA-YPAHRPLHELYSPPGLDAHYGPLLMPAVRPPHLPTLPGHYDVGKLEPTATWPGLLPP 261

  Fly   438 AQVAQV-----------QESSKDLYWF 453
            ..|||.           .:..|:||||
Zfish   262 GDVAQSLALNMEPGLQHHKKGKELYWF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 20/30 (67%)
vgll2bNP_001028267.1 Vg_Tdu 89..118 CDD:284876 19/28 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595173
Domainoid 1 1.000 46 1.000 Domainoid score I12112
eggNOG 1 0.900 - - E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146285at2759
OrthoFinder 1 1.000 - - FOG0007006
OrthoInspector 1 1.000 - - otm25976
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7863
SonicParanoid 1 1.000 - - X2352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.