DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vg and VGLL3

DIOPT Version :9

Sequence 1:NP_523723.1 Gene:vg / 36421 FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_057290.2 Gene:VGLL3 / 389136 HGNCID:24327 Length:326 Species:Homo sapiens


Alignment Length:256 Identity:74/256 - (28%)
Similarity:99/256 - (38%) Gaps:91/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 QAQYLSASCVVFTNYSGDTASQVDEHFSRALNYN---------NKDS-------KESSSPMSNRN 328
            :.:||::.||:||.:.||..|.|||||||||...         :|..       ::||:..|.||
Human    80 EMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRN 144

  Fly   329 -FPPSFWNSNYVHPIPAP----TH--HQVSDLYGT--ATDTGYATDPWVPHAAHY---------- 374
             ||.|||.|:| .|.|||    .|  .||:...||  |.|    ..||..|..|.          
Human   145 SFPTSFWTSSY-QPPPAPCLGGVHPDFQVTGPPGTFSAAD----PSPWPGHNLHQTGPAPPPAVS 204

  Fly   375 ------------GSYAHA---------AHAHAAHAHAYHHNM----------AQYGSLLRLPQQY 408
                        .||:|.         .|||..|.|.:||:.          ..||.|| :|   
Human   205 ESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLL-MP--- 265

  Fly   409 ASHGSRLHHDQ----QTAHALEYSSYPTMAG-------LEAQVA-----QVQESSKDLYWF 453
            :.|.:|:...|    :|......|:....||       :...|.     |.|:.||:..|:
Human   266 SVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 18/29 (62%)
VGLL3NP_057290.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..80 74/256 (29%)
Vg_Tdu 82..112 CDD:369418 18/29 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..203 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..256 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159114
Domainoid 1 1.000 43 1.000 Domainoid score I12374
eggNOG 1 0.900 - - E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41435
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7863
SonicParanoid 1 1.000 - - X2352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.