DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vg and Vgll1

DIOPT Version :9

Sequence 1:NP_523723.1 Gene:vg / 36421 FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_008771890.1 Gene:Vgll1 / 363508 RGDID:1564038 Length:229 Species:Rattus norvegicus


Alignment Length:204 Identity:59/204 - (28%)
Similarity:77/204 - (37%) Gaps:60/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SASCVVFTNYSGDTASQVDEHFSRALNYNNKDSKESSSPMSNRN--------FPPSFW-NSNYVH 340
            ||.||:||.:.||.:|.|||||||||: |.|..:|.||...:.|        .||:.| .|::..
  Rat    24 SAQCVLFTYFQGDISSVVDEHFSRALS-NLKRPQELSSSSHSENVILKNDSSMPPNQWCLSSWKK 87

  Fly   341 PIP--APTHHQVS---DLYGTATDTGYATDPWVPHAAHYGSYAHAAHAHAAHAHAYHHNMAQYGS 400
            |.|  :|.:...|   |.||.....      |.|.:.....|||.            ..:.|:.|
  Rat    88 PQPETSPANGASSSSLDEYGPKAMN------WHPLSLPKTPYAHP------------QELWQFPS 134

  Fly   401 LLR-----------------LPQQY--ASHGSRLHHDQQTAH--------ALEYSSYPTMAGLEA 438
            ..|                 .||.|  ..|||..|..|:..|        |....|:...||..|
  Rat   135 SARPEFLEPAYFRVFPDRHLAPQVYPDGRHGSLQHLVQEVRHQNHRLEPAAKASCSHVKTAGSTA 199

  Fly   439 QVAQVQESS 447
            .:..:..||
  Rat   200 SLLNLPPSS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 18/26 (69%)
Vgll1XP_008771890.1 Vg_Tdu 21..51 CDD:284876 18/27 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.