DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vg and vgll1

DIOPT Version :9

Sequence 1:NP_523723.1 Gene:vg / 36421 FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_002932640.1 Gene:vgll1 / 100302396 XenbaseID:XB-GENE-982100 Length:227 Species:Xenopus tropicalis


Alignment Length:240 Identity:57/240 - (23%)
Similarity:77/240 - (32%) Gaps:104/240 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 LSASCVVFTNYSGDTASQVDEHFSRALNYNNKDSKESSSPMSNRNFPPS----------FWNSNY 338
            |.:.|||||.|.||..|.|||||||||. ..||.::.|:.....::.|.          .|...|
 Frog    22 LGSRCVVFTYYQGDINSVVDEHFSRALR-TIKDPQDLSTKNRGDDYLPKNMSTMATDDMNWTKTY 85

  Fly   339 ------------VHPIPAPTHHQVSDLYGTATDTGYATDPWVPHAAHYGSYAHAAHAHAAHAHAY 391
                        :.|:|:     .||.|.|...|.       ||.....|..|.. .|...|..|
 Frog    86 QATPPVRMPASVLTPVPS-----TSDHYATVFQTH-------PHQQDVWSLYHIG-PHNPIAPVY 137

  Fly   392 HHNMAQY------------GSLLRLPQQYASHGSRLHHDQQTAHALEYSSYP------------- 431
            .|:::.:            ||||.|                    |::..||             
 Frog   138 QHSVSDFPMVPGTGPDGKPGSLLSL--------------------LQHERYPVPLQESMIKQEIL 182

  Fly   432 --TMAGLEAQV---------------------AQVQESSKDLYWF 453
              |.:|:.|.|                     ...|:..||||::
 Frog   183 TSTSSGISAPVNPNPRMNPQTDLHSQDRRKDYFHPQDRRKDLYFY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 19/27 (70%)
vgll1XP_002932640.1 Vg_Tdu 20..49 CDD:369418 18/26 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12086
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.