DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmda1 and AT1G03070

DIOPT Version :9

Sequence 1:NP_523722.1 Gene:Nmda1 / 36419 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001184896.1 Gene:AT1G03070 / 839581 AraportID:AT1G03070 Length:247 Species:Arabidopsis thaliana


Alignment Length:225 Identity:76/225 - (33%)
Similarity:130/225 - (57%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKT-FARNNMWL-FWVALGVMLVTMLSMA 167
            :...:|.|||||||.|:..||:.|....:..|:...... ||..:..| .|:   |:::|.|.:.
plant    30 ESPELRWGFIRKVYSIIAFQLLATIAVASTVVFVRPIAVFFATTSAGLALWI---VLIITPLIVM 91

  Fly   168 C-CESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIF---ALQTK 228
            | .....::.|.|::.||:||.|.:|.:|::....:.|.:|.|..:|..|.|:||::   |.:..
plant    92 CPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVILEAAILTTVVVLSLTVYTFWAAKKG 156

  Fly   229 YDFTMMGGILIACMVVFLIFGIVAIFVK-GKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSI 292
            |||..:|..|...::|.::|.::.||.. |:|..::|..:.|::|..|::|||..::   .:||.
plant   157 YDFNFLGPFLFGALIVLMVFALIQIFFPLGRISVMIYGCLAAIIFCGYIVYDTDNLI---KRYSY 218

  Fly   293 SPEEYIFAALNLYLDIINIFMYILTIIGAS 322
              :|||:||::|||||||:|:.:|||..|:
plant   219 --DEYIWAAVSLYLDIINLFLALLTIFRAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 75/221 (34%)
AT1G03070NP_001184896.1 GAAP_like 5..247 CDD:198411 76/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1887
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm996
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.